PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00154727001
Common NameGSBRNA2T00154727001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 423aa    MW: 46906 Da    PI: 6.914
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00154727001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.23.9e-33239293155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fvea+++LGGse+AtPk +l++mkv+gLt++hvkSHLQkYR+
  GSBRNA2T00154727001 239 KARMRWTPELHEAFVEAINSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQKYRT 293
                          68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.694236296IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-30238295IPR009057Homeodomain-like
SuperFamilySSF466898.96E-17238293IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-24239293IPR006447Myb domain, plants
PfamPF002491.8E-8241292IPR001005SANT/Myb domain
PfamPF143792.9E-24327370IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MRDLMIRFRV HPLESSRTDK SSSFTVITKV LETTMEARPV QRSGSMVLSN LTRTTTSIPS  60
NPSTGEESFM RSDNTQFISK PLGQQTYHLL SSSNNGAVGH ICSSTSSGFS TNLHYSSMVS  120
HEKHGSSSND TSWCHDSPHG GFLDFPEASH VADGGIGSAF DDIQKRNDWH EWADHLITDE  180
DPLLSTSWND LLLNTSSHSD SKVQIPPQAH QTVQQQPSPS VELRPVGTTS SSSNNGTGKA  240
RMRWTPELHE AFVEAINSLG GSERATPKGV LKIMKVEGLT IYHVKSHLQK YRTARYRPEP  300
SENGSSEKKL TPLEHITSLD LKGGIGITEA LRLQMEVQKQ LHEQLEIQRN LQLRIEEQGK  360
YLQMMFEKQN SGLEKGTASK SDTSAKSEQE DKKTDASKEL ASEETRNSQE PESSQAKRTK  420
TR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.256501e-115flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00154727001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3107990.0AJ310799.1 Arabidopsis thaliana mRNA for phosphate starvation response regulator 1 (phr1 gene).
GenBankJN0098020.0JN009802.1 UNVERIFIED: Lupinus polyphyllus phosphate starvation response regulator-like mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013707716.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_013707715.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_013707714.10.0PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ8GUN55e-75PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078DVH70.0A0A078DVH7_BRANA; BnaC07g41450D protein
STRINGAT4G28610.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.10.0phosphate starvation response 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]